Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBR3 Peptide - C-terminal region

UBR3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZNF650

UniProt

Q6ZT12

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBR3 Rabbit Polyclonal Antibody (orb55680) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Acetyl-2-norbornene
TRC-A187150-2.5G 2.5 g

5-Acetyl-2-norbornene

Sign In for Pricing
View Details
Recombinant Cytokeratin-17 Antibody
RC-16708-01 50 μL

Recombinant Cytokeratin-17 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-17 Antibody
RC-16708-02 100 µL

Recombinant Cytokeratin-17 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-17 Antibody
RC-16708-03 1 mL

Recombinant Cytokeratin-17 Antibody

Sign In for Pricing
View Details
Vedolizumab Biosimilar - Research Grade
ICH4035-50mg 50 mg

Vedolizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Fenaminstrobin (E/Z Mixture)
TRC-F245600-50MG 50 mg

Fenaminstrobin (E/Z Mixture)

Sign In for Pricing
View Details