Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBR3 Peptide - C-terminal region

UBR3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZNF650

UniProt

Q6ZT12

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBR3 Rabbit Polyclonal Antibody (orb55680) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TUBD1 activation kit by CRISPRa
GA109625 1 Kit

Human TUBD1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human LOC645177 activation kit by CRISPRa
GA118752 1 Kit

Human LOC645177 activation kit by CRISPRa

Sign In for Pricing
View Details
Clec4b2 Mouse Gene Knockout Kit (CRISPR)
KN503448 1 Kit

Clec4b2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SMURF1 Recombinant Rabbit monoclonal Antibody
HA723181 100 µL

SMURF1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Multi-Well Plates
DP17US-9-N 50 Pack/Case

Multi-Well Plates

Sign In for Pricing
View Details
Cpt1a Mouse Gene Knockout Kit (CRISPR)
KN503783 1 Kit

Cpt1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details