UBR3 Peptide - C-terminal region
UBR3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ZNF650
UniProt
Q6ZT12
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UBR3 Rabbit Polyclonal Antibody (orb55680) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGKP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB0960-100 1x 100 µL
MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 