Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG13 Peptide - middle region

ATG13 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA0652, PARATARG8

UniProt

O75143

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001136145.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVELEGESS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PLAC1L (OOSP2) activation kit by CRISPRa
GA116550 1 Kit

Human PLAC1L (OOSP2) activation kit by CRISPRa

Sign In for Pricing
View Details
Propiolamide
TRC-P780000-1G 1 g

Propiolamide

Sign In for Pricing
View Details
PRR20A Human Gene Knockout Kit (CRISPR)
KN423756 1 Kit

PRR20A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(-)-a-Cedrene (major, contains (+)-b-cedrene)
TRC-C364863-5G 5 g

(-)-a-Cedrene (major, contains (+)-b-cedrene)

Sign In for Pricing
View Details
Disperse Red 60 (Technical Grade)
TRC-D014960-250MG 250 mg

Disperse Red 60 (Technical Grade)

Sign In for Pricing
View Details
Dpp4 Mouse Gene Knockout Kit (CRISPR)
KN304781RB 1 Kit

Dpp4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details