Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG13 Peptide - middle region

ATG13 Peptide - middle region

Product Specifications

Product Name Alternative

KIAA0652, PARATARG8

UniProt

O75143

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001136145.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVELEGESS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSL1 (NM_001042549) Human Over-expression Lysate
LC425772 20 µg

NSL1 (NM_001042549) Human Over-expression Lysate

Sign In for Pricing
View Details
Ceramide synthase 1 (CERS1) (Cross reacts with GDF1) Rabbit Polyclonal Antibody
AP05285PU-N 100 µg

Ceramide synthase 1 (CERS1) (Cross reacts with GDF1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Fbp2 activation kit by CRISPRa
GA201368 1 Kit

Mouse Fbp2 activation kit by CRISPRa

Sign In for Pricing
View Details
MAP3K10 Antibody
8C10857-AAT 50 µg

MAP3K10 Antibody

Sign In for Pricing
View Details
SFTPA1 (NM_001164646) Human Recombinant Protein
TP328130M 100 µg

SFTPA1 (NM_001164646) Human Recombinant Protein

Sign In for Pricing
View Details
Crct1 (NM_028798) Mouse Tagged ORF Clone
MG200322 10 µg

Crct1 (NM_028798) Mouse Tagged ORF Clone

Sign In for Pricing
View Details