Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSEN2 Peptide - middle region

TSEN2 Peptide - middle region

Product Specifications

Product Name Alternative

SEN2, PCH2B, SEN2L

UniProt

Q8NCE0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138864.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGMVSNMEGTAGGERPSVVNGDSGKSGGVGDPREPLGCLQEGSGCHPTTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S-Transferase Mu1 (GSTM1) (CPTC-GSTMu1-3), CF594 conjugate, 0.1mg/mL
BNC942241-500 1x 500 µL

Glutathione S-Transferase Mu1 (GSTM1) (CPTC-GSTMu1-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Abiraterone Acetate
TRC-A108500-5MG 5 mg

Abiraterone Acetate

Sign In for Pricing
View Details
Frozen Tissue Sections, Neurovascular bundle
CS627148 5x 5 µm

Frozen Tissue Sections, Neurovascular bundle

Sign In for Pricing
View Details
SP110 (NM_001185015) Human Over-expression Lysate
LY433264 100 µg

SP110 (NM_001185015) Human Over-expression Lysate

Sign In for Pricing
View Details
Human B7-1 (CD80) ELISA Kit 1 x 96
EA200057 96 Well

Human B7-1 (CD80) ELISA Kit 1 x 96

Sign In for Pricing
View Details
Integrin beta 1 (ITGB1) Human Gene Knockout Kit (CRISPR)
KN203818BN 1 Kit

Integrin beta 1 (ITGB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details