Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOM1L2 Peptide - C-terminal region

TOM1L2 Peptide - C-terminal region

Product Specifications

UniProt

Q6ZVM7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001028723.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEEFDKFLEERAKAAEMVPDLPSPPMEAPAPASNPSGRKKPERSEDALFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arsenic Oxide (As2O3)
TRC-A774130-25G 25 g

Arsenic Oxide (As2O3)

Sign In for Pricing
View Details
Ascorbic Acid 2-sulfate Dipotassium Salt Dihydrate
TRC-A787018-250MG 250 mg

Ascorbic Acid 2-sulfate Dipotassium Salt Dihydrate

Sign In for Pricing
View Details
Anti-Arabinogalactan-Protein, AGP (monoclonal, clone JIM4)
AS22 4743-1ml 1 mL

Anti-Arabinogalactan-Protein, AGP (monoclonal, clone JIM4)

Sign In for Pricing
View Details
a-D-Digitoxopyranosyl-oxy 12b-Acetyldigoxigenin
TRC-D173940-50MG 50 mg

a-D-Digitoxopyranosyl-oxy 12b-Acetyldigoxigenin

Sign In for Pricing
View Details
Human CREG2 activation kit by CRISPRa
GA116349 1 Kit

Human CREG2 activation kit by CRISPRa

Sign In for Pricing
View Details
Optitrol Green
SR11043 2x 5 mL

Optitrol Green

Sign In for Pricing
View Details