Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOM1L2 Peptide - C-terminal region

TOM1L2 Peptide - C-terminal region

Product Specifications

UniProt

Q6ZVM7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001028723.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEEFDKFLEERAKAAEMVPDLPSPPMEAPAPASNPSGRKKPERSEDALFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant RTN4RL1 Antibody
RC-5825-01 50 μL

Recombinant RTN4RL1 Antibody

Sign In for Pricing
View Details
Recombinant RTN4RL1 Antibody
RC-5825-02 100 µL

Recombinant RTN4RL1 Antibody

Sign In for Pricing
View Details
Recombinant RTN4RL1 Antibody
RC-5825-03 1 mL

Recombinant RTN4RL1 Antibody

Sign In for Pricing
View Details
Recombinant Human hnRNPK protein (GST, His tag)
PDEH101052-01 20 µg

Recombinant Human hnRNPK protein (GST, His tag)

Sign In for Pricing
View Details
Recombinant Human hnRNPK protein (GST, His tag)
PDEH101052-02 100 µg

Recombinant Human hnRNPK protein (GST, His tag)

Sign In for Pricing
View Details
Recombinant Human hnRNPK protein (GST, His tag)
PDEH101052-03 500 µg

Recombinant Human hnRNPK protein (GST, His tag)

Sign In for Pricing
View Details