Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOL6 Peptide - middle region

APOL6 Peptide - middle region

Product Specifications

Product Name Alternative

APOLVI, APOL-VI

UniProt

Q9BWW8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_085144.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSKNKEAQARAEDILPTYDQEDREDEEEKADYVTAAGKIIYNLRNTLKYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Etigilimab Biosimilar - Research Grade
ICH5536-10mg 10 mg (2x 5 mg)

Etigilimab Biosimilar - Research Grade

Sign In for Pricing
View Details
MFF CRISPRa sgRNA lentivector (set of three targets)(Rat)
28440126 3x 1.0µg DNA

MFF CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Chromogranin C (SCG2) (NM_003469) Human Over-expression Lysate
LY418654 100 µg

Chromogranin C (SCG2) (NM_003469) Human Over-expression Lysate

Sign In for Pricing
View Details
Ceftizoxime sodium salt
GA1247-1g 1 g

Ceftizoxime sodium salt

Sign In for Pricing
View Details
Recombinant Human Medium-wave-sensitive opsin 2 (OPSG2), partial
orb3009718-01 20 µg

Recombinant Human Medium-wave-sensitive opsin 2 (OPSG2), partial

Sign In for Pricing
View Details
Recombinant Human Medium-wave-sensitive opsin 2 (OPSG2), partial
orb3009718-02 100 µg

Recombinant Human Medium-wave-sensitive opsin 2 (OPSG2), partial

Sign In for Pricing
View Details