Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOL6 Peptide - middle region

APOL6 Peptide - middle region

Product Specifications

Product Name Alternative

APOLVI, APOL-VI

UniProt

Q9BWW8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_085144.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSKNKEAQARAEDILPTYDQEDREDEEEKADYVTAAGKIIYNLRNTLKYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK10 (NIMA (never in Mitosis Gene a) - Related Kinase 10, FLJ32685)
249217 50 µL

NEK10 (NIMA (never in Mitosis Gene a) - Related Kinase 10, FLJ32685)

Sign In for Pricing
View Details
Human RNF223 knockout cell line
ABC-KH13091 1 Vial

Human RNF223 knockout cell line

Sign In for Pricing
View Details
KLF6 (Kruppel-like Factor 6, B-cell derived 1, Core promoter Element Binding Protein, Core Promoter Element-Binding Protein, N-terminus truncated, Prostate Adenocarcinoma-1, Protooncogene BCD1, Suppression of tumorigenicity 12 (prostate), BCD1, COPEB, CPBP, DKFZp686N0199, GBF, PAC1, ST12, ZF9) (MaxLight 405) discontinued
207751-ML405 100 µL

KLF6 (Kruppel-like Factor 6, B-cell derived 1, Core promoter Element Binding Protein, Core Promoter Element-Binding Protein, N-terminus truncated, Prostate Adenocarcinoma-1, Protooncogene BCD1, Suppression of tumorigenicity 12 (prostate), BCD1, COPEB, CPBP, DKFZp686N0199, GBF, PAC1, ST12, ZF9) (MaxLight 405) discontinued

Sign In for Pricing
View Details
MVK Antibody
E30AC1991 100 µL

MVK Antibody

Sign In for Pricing
View Details
Goat Anti-Mouse IgG (H+L) Antibody (FITC)
abx201415-01 60 µL

Goat Anti-Mouse IgG (H+L) Antibody (FITC)

Sign In for Pricing
View Details
Goat Anti-Mouse IgG (H+L) Antibody (FITC)
abx201415-02 120 µL

Goat Anti-Mouse IgG (H+L) Antibody (FITC)

Sign In for Pricing
View Details