What is the catalog number for NDRG4 Peptide - middle region?

The catalog number for NDRG4 Peptide - middle region is orb1999743.

What sizes are available for NDRG4 Peptide - middle region?

NDRG4 Peptide - middle region is available in the following size(s): 100 µg.

Is NDRG4 Peptide - middle region in stock?

NDRG4 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

NDRG4 Peptide - middle region

Product Specifications

Product Name Alternative

BDM1, SMAP8, SMAP-8

UniProt

Q9ULP0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123959.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TP316492L 1 mg

ANGEL2 (NM_144567) Human Recombinant Protein

Sign In for Pricing

View Details

sc-289503 100 mg

4- (4-chlorophenyl) -1H-pyrazol-3-amine

Sign In for Pricing

View Details

K4452003 1.0 µg DNA

Nr2c2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing

View Details

RG238158 10 µg

TTC39A (NM_001297662) Human Tagged ORF Clone

Sign In for Pricing

View Details

TMPY-02345-01 5 µg

Interferon alpha 14/IFNA14 Protein, Mouse, Recombinant (hFc)

Sign In for Pricing

View Details

TMPY-02345-02 10 µg

Interferon alpha 14/IFNA14 Protein, Mouse, Recombinant (hFc)

Sign In for Pricing

View Details