Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDRG4 Peptide - middle region

NDRG4 Peptide - middle region

Product Specifications

Product Name Alternative

BDM1, SMAP8, SMAP-8

UniProt

Q9ULP0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123959.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bone Sialoprotein (BSP) Guinea Pig ELISA Kit
B9437 96 Tests

Bone Sialoprotein (BSP) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
IFluor® 700 Anti-human CD140a Antibody *16A1*
114000J0-AAT 100 Tests

IFluor® 700 Anti-human CD140a Antibody *16A1*

Sign In for Pricing
View Details
Talin 1/TLN1 Rabbit Polyclonal Antibody (Fluoro550)
orb3109445 100 µg

Talin 1/TLN1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Goat Anti-Pig IgG H&L Antibody (Biotin)
abx134888-01 100 µL

Goat Anti-Pig IgG H&L Antibody (Biotin)

Sign In for Pricing
View Details
Goat Anti-Pig IgG H&L Antibody (Biotin)
abx134888-02 500 µL

Goat Anti-Pig IgG H&L Antibody (Biotin)

Sign In for Pricing
View Details
Goat Anti-Pig IgG H&L Antibody (Biotin)
abx134888-03 1 mL

Goat Anti-Pig IgG H&L Antibody (Biotin)

Sign In for Pricing
View Details