Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFT81 Peptide - C-terminal region

IFT81 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DV1, CDV1, CDV-1, CDV1R, CDV-1R

UniProt

Q8WYA0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001137251.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2B1 Protein Lysate (Rat) with C-HA Tag
43647036 100 µg

SH2B1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
KMT4 Polyclonal Antibody, PE-Cy7 Conjugated
bs-16797R-PE-Cy7 100 µL

KMT4 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C, ALS8, VAMP-B, VAMP-C, VAP-B, VAP-C) (MaxLight 490)
MBS6451823-01 0.1 mL

VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C, ALS8, VAMP-B, VAMP-C, VAP-B, VAP-C) (MaxLight 490)

Sign In for Pricing
View Details
VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C, ALS8, VAMP-B, VAMP-C, VAP-B, VAP-C) (MaxLight 490)
MBS6451823-02 5x 0.1 mL

VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C, ALS8, VAMP-B, VAMP-C, VAP-B, VAP-C) (MaxLight 490)

Sign In for Pricing
View Details
Mouse Monoclonal CD45RA Antibody (K4B5) - Azide and BSA Free
NBP3-08901 100 µg

Mouse Monoclonal CD45RA Antibody (K4B5) - Azide and BSA Free

Sign In for Pricing
View Details
Mouse FCRL1 Protein, His Tag
E40MOP1754 20 µg

Mouse FCRL1 Protein, His Tag

Sign In for Pricing
View Details