What is the catalog number for IFT81 Peptide - C-terminal region?

The catalog number for IFT81 Peptide - C-terminal region is orb1999732.

What sizes are available for IFT81 Peptide - C-terminal region?

IFT81 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is IFT81 Peptide - C-terminal region in stock?

IFT81 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

IFT81 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DV1, CDV1, CDV-1, CDV1R, CDV-1R

UniProt

Q8WYA0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001137251.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-08751PCP 0.1 mL

Mouse Monoclonal Nrf1 Antibody (NRF1/2608) [PerCP]

Sign In for Pricing

View Details

135845 1 Pack (1 Panel (s) x 1 Pack)

W/W037/NT-ALU-PHOLUMC-TRI150/1-B Electrical & Equipment Safety Signs (No Adhesive)

Sign In for Pricing

View Details

LV716056 1.0 µg DNA

TMEM171 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing

View Details

bs-11448R-Cy5.5 100 µL

Phospho-AANAT (Thr29) Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing

View Details

MBS146014-01 0.002 mg

Recombinant Human Mediator Complex Subunit 27

Sign In for Pricing

View Details

MBS146014-02 0.01 mg

Recombinant Human Mediator Complex Subunit 27

Sign In for Pricing

View Details