Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIC Peptide - middle region

PPIC Peptide - middle region

Product Specifications

Product Name Alternative

CYPC

UniProt

P45877

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000934.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCAKD (Dephospho-CoA Kinase Domain-containing Protein, FLJ22955) (HRP)
MBS6375703-01 0.1 mL

DCAKD (Dephospho-CoA Kinase Domain-containing Protein, FLJ22955) (HRP)

Sign In for Pricing
View Details
DCAKD (Dephospho-CoA Kinase Domain-containing Protein, FLJ22955) (HRP)
MBS6375703-02 5x 0.1 mL

DCAKD (Dephospho-CoA Kinase Domain-containing Protein, FLJ22955) (HRP)

Sign In for Pricing
View Details
Androgen Receptor (M23G3) Rabbit mAb
C06587-20uL 20 µL

Androgen Receptor (M23G3) Rabbit mAb

Sign In for Pricing
View Details
FLT1 Antibody, HRP conjugated
MBS7049493-01 0.05 mg

FLT1 Antibody, HRP conjugated

Sign In for Pricing
View Details
FLT1 Antibody, HRP conjugated
MBS7049493-02 0.1 mg

FLT1 Antibody, HRP conjugated

Sign In for Pricing
View Details
FLT1 Antibody, HRP conjugated
MBS7049493-03 5x 0.1 mg

FLT1 Antibody, HRP conjugated

Sign In for Pricing
View Details