PPIC Peptide - middle region
PPIC Peptide - middle region
Product Specifications
Product Name Alternative
CYPC
UniProt
P45877
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_000934.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0029818 96 Tests
Multiplex Assay Kit for Collagen Type III Alpha 1 (COL3a1), etc. by FLIA (Flow Luminescence Immunoassay)
Sign In for Pricing
View Details 
TMPH-00516-01 5 µg
StxA2 Protein, Enterobacteria phage 933W, Recombinant (E189K, His & Myc)
Sign In for Pricing
View Details TMPH-00516-02 10 µg
StxA2 Protein, Enterobacteria phage 933W, Recombinant (E189K, His & Myc)
Sign In for Pricing
View Details TMPH-00516-03 20 µg
StxA2 Protein, Enterobacteria phage 933W, Recombinant (E189K, His & Myc)
Sign In for Pricing
View Details TMPH-00516-04 50 µg
StxA2 Protein, Enterobacteria phage 933W, Recombinant (E189K, His & Myc)
Sign In for Pricing
View Details TMPH-00516-05 100 µg
StxA2 Protein, Enterobacteria phage 933W, Recombinant (E189K, His & Myc)
Sign In for Pricing
View Details