Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1D Peptide - middle region

EEF1D Peptide - middle region

Product Specifications

Product Name Alternative

EF1D, EF-1D, FP1047

UniProt

P29692

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123525.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Masses Set, Slotted And Hangers, Brass
2012920/5 1 Each

Masses Set, Slotted And Hangers, Brass

Sign In for Pricing
View Details
SVS4 siRNA (Rat)
CRR0301-01 15 nmol

SVS4 siRNA (Rat)

Sign In for Pricing
View Details
SVS4 siRNA (Rat)
CRR0301-02 30 nmol

SVS4 siRNA (Rat)

Sign In for Pricing
View Details
PCMP-E74 Antibody
orb794348 2 mg

PCMP-E74 Antibody

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD127/IL-7RA Antibody[A019D5]
E-AB-F1152L-01 20 Tests

Elab Fluor® 488 Anti-Human CD127/IL-7RA Antibody[A019D5]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD127/IL-7RA Antibody[A019D5]
E-AB-F1152L-02 100 Tests

Elab Fluor® 488 Anti-Human CD127/IL-7RA Antibody[A019D5]

Sign In for Pricing
View Details