Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYBPC1 Peptide - N-terminal region

MYBPC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LCCS4, MYBPCC, MYBPCS

UniProt

Q00872

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001241647.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S-Carnitine Mesylate Isobutylester, Mesylate Salt
C1385-29F 25 mg

S-Carnitine Mesylate Isobutylester, Mesylate Salt

Sign In for Pricing
View Details
PAI-RBP1 (F-8) Alexa Fluor® 647
sc-376832 AF647 200 µg/mL

PAI-RBP1 (F-8) Alexa Fluor® 647

Sign In for Pricing
View Details
PILR-β shRNA (h) Lentiviral Particles
sc-89579-V 200 µL

PILR-β shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
HLA-DMB antibody
22356 100 µL

HLA-DMB antibody

Sign In for Pricing
View Details
RABL4 Protein Vector (Human) (pPB-N-His)
PV034126 500 ng

RABL4 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
WTAP (m) -PR
sc-63225-PR 10 µM - 20 µL

WTAP (m) -PR

Sign In for Pricing
View Details