Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP54 Peptide - middle region

NUP54 Peptide - middle region

Product Specifications

UniProt

Q7Z3B4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_059122.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVERSPNGTSRRVPATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS633994 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Human Azurocidin 1 (AZU1) ELISA Kit
RD-AZU1-Hu-01 96 Tests

Human Azurocidin 1 (AZU1) ELISA Kit

Sign In for Pricing
View Details
Human Azurocidin 1 (AZU1) ELISA Kit
RD-AZU1-Hu-02 48 Tests

Human Azurocidin 1 (AZU1) ELISA Kit

Sign In for Pricing
View Details
TBL1X Antibody
KC-30634-01 50 μL

TBL1X Antibody

Sign In for Pricing
View Details
TBL1X Antibody
KC-30634-02 100 µL

TBL1X Antibody

Sign In for Pricing
View Details
TBL1X Antibody
KC-30634-03 1 mL

TBL1X Antibody

Sign In for Pricing
View Details