Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP54 Peptide - middle region

NUP54 Peptide - middle region

Product Specifications

UniProt

Q7Z3B4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_059122.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVERSPNGTSRRVPATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTH1 (NTHL1) Rabbit Polyclonal Antibody
TA361443 100 µL

NTH1 (NTHL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Rat OLR1/LOX1 Protein (His Tag)
PKSR030274 50 µg

Recombinant Rat OLR1/LOX1 Protein (His Tag)

Sign In for Pricing
View Details
CLPSL2 (NM_207409) Human Over-expression Lysate
LC404015 20 µg

CLPSL2 (NM_207409) Human Over-expression Lysate

Sign In for Pricing
View Details
3,5-Di-tert-butyl-o-benzoquinone
TRC-D428020-1G 1 g

3,5-Di-tert-butyl-o-benzoquinone

Sign In for Pricing
View Details
CALCA Monoclonal Antibody [Clone ID: 9D9.E11.C3.E8.F4.D4]
TA396809 100 µg

CALCA Monoclonal Antibody [Clone ID: 9D9.E11.C3.E8.F4.D4]

Sign In for Pricing
View Details
TMK4 Rabbit Polyclonal Antibody
HA500435 100 µL

TMK4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details