Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGR Peptide - middle region

FGR Peptide - middle region

Product Specifications

Product Name Alternative

SRC2, c-fgr, c-src2, p55-Fgr, p58-Fgr, p55c-fgr, p58c-fgr

UniProt

P09769

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001036194.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLSPGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHVKHYKIRKLDMGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF568 conjugate, 0.1mg/mL
BNC681758-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Ccl17 (NM_011332) AAV Particle
MR200247A1V 250 µL

Mouse Ccl17 (NM_011332) AAV Particle

Sign In for Pricing
View Details
O-t-Butyldiphenylsilylhydroxylamine
TRC-B820030-500MG 500 mg

O-t-Butyldiphenylsilylhydroxylamine

Sign In for Pricing
View Details
Desamino-hydroxy Revefenacin Ammonium Salt
TRC-D120890-2.5MG 2.5 mg

Desamino-hydroxy Revefenacin Ammonium Salt

Sign In for Pricing
View Details
CPA4 (NM_016352) Human Recombinant Protein
TP308575M 100 µg

CPA4 (NM_016352) Human Recombinant Protein

Sign In for Pricing
View Details
RPS6KC1 (N-term) Rabbit Polyclonal Antibody
AP53746PU-N 400 µL

RPS6KC1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details