Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGR Peptide - middle region

FGR Peptide - middle region

Product Specifications

Product Name Alternative

SRC2, c-fgr, c-src2, p55-Fgr, p58-Fgr, p55c-fgr, p58c-fgr

UniProt

P09769

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001036194.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLSPGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHVKHYKIRKLDMGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAALADL1 Human Gene Knockout Kit (CRISPR)
KN417792 1 Kit

NAALADL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fmoc-Ala TentaGel® R HMPA Resin
RA1501.1G 1 g

Fmoc-Ala TentaGel® R HMPA Resin

Sign In for Pricing
View Details
Laminin alpha 4 (LAMA4) Mouse Monoclonal Antibody [Clone ID: OTI5G8]
CF805721 100 µg

Laminin alpha 4 (LAMA4) Mouse Monoclonal Antibody [Clone ID: OTI5G8]

Sign In for Pricing
View Details
Bisphenol A Monosulfate Sodium Salt-d6 (90%)
TRC-B519563-2.5MG 2.5 mg

Bisphenol A Monosulfate Sodium Salt-d6 (90%)

Sign In for Pricing
View Details
Serum Amyloid A (SAA/326), CF405S conjugate, 0.1mg/mL
BNC040326-100 1x 100 µL

Serum Amyloid A (SAA/326), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bisphenol A Monosulfate Sodium Salt
TRC-B519560-10MG 10 mg

Bisphenol A Monosulfate Sodium Salt

Sign In for Pricing
View Details