Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARD14 Peptide - middle region

CARD14 Peptide - middle region

Product Specifications

Product Name Alternative

PRP, PSS1, BIMP2, CARMA2, PSORS2

UniProt

Q9BXL6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001244899.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQCTVTRKPSSGGPQKLVRIVSMDKAKASPLRLSFDRGQLDPSRMEGSST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine BMP4 Protein, N-FC
orb3155109-01 50 µg

Recombinant Bovine BMP4 Protein, N-FC

Sign In for Pricing
View Details
Recombinant Bovine BMP4 Protein, N-FC
orb3155109-02 100 µg

Recombinant Bovine BMP4 Protein, N-FC

Sign In for Pricing
View Details
Recombinant Bovine BMP4 Protein, N-FC
orb3155109-03 1 mg

Recombinant Bovine BMP4 Protein, N-FC

Sign In for Pricing
View Details
Rat Diphtheria Antibody DA ELISA Kit
BG-RAT10792 1 Each

Rat Diphtheria Antibody DA ELISA Kit

Sign In for Pricing
View Details
S100 Calcium Binding Protein A4 (S100A4) Magnetic Luminex Assay Kit
LKU607048 96 Tests

S100 Calcium Binding Protein A4 (S100A4) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
OR2W1 antibody
70R-9892 100 µL

OR2W1 antibody

Sign In for Pricing
View Details