What is the catalog number for ASAP3 Peptide - middle region?

The catalog number for ASAP3 Peptide - middle region is orb1999610.

What sizes are available for ASAP3 Peptide - middle region?

ASAP3 Peptide - middle region is available in the following size(s): 100 µg.

Is ASAP3 Peptide - middle region in stock?

ASAP3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ASAP3 Peptide - middle region

Product Specifications

Product Name Alternative

ACAP4, UPLC1, CENTB6, DDEFL1

UniProt

O43150

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001137250.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-28076JF669 0.1 mL

Human Monoclonal Carbonic Anhydrase IX/CA9 Antibody (girentuximab) [Janelia Fluor 669]

Sign In for Pricing

View Details

RP145790 100 µg

KIN Recombinant Protein (Mouse)

Sign In for Pricing

View Details

037325-ML405 100 µL

KCNJ13, NT (KCNJ13, Inward rectifier potassium channel 13, Inward rectifier K (+) channel Kir7.1, Potassium channel, inwardly rectifying subfamily J member 13) (MaxLight 405) discontinued

Sign In for Pricing

View Details

orb562707-01 48 Tests

Human HAS2 ELISA Kit

Sign In for Pricing

View Details

orb562707-02 96 Tests

Human HAS2 ELISA Kit

Sign In for Pricing

View Details

MBS1600016-01 48 Well

Human CD59 glycoprotein (CD59) ELISA Kit

Sign In for Pricing

View Details