Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TICAM2 Peptide - N-terminal region

TICAM2 Peptide - N-terminal region

Product Specifications

UniProt

Q86XR7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001157940.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJB5 Human Gene Knockout Kit (CRISPR)
KN422132 1 Kit

DNAJB5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C11orf98 (NM_001286086) Human Tagged ORF Clone
RG235806 10 µg

C11orf98 (NM_001286086) Human Tagged ORF Clone

Sign In for Pricing
View Details
TA3 (TAAR9) Human Gene Knockout Kit (CRISPR)
KN423711 1 Kit

TA3 (TAAR9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chlorfenapyr-d7
TRC-C428504-1MG 1 mg

Chlorfenapyr-d7

Sign In for Pricing
View Details
Protein A PCR Plates - non skirted
PCR960106-PA 10 Plates

Protein A PCR Plates - non skirted

Sign In for Pricing
View Details
Ethanethioic Acid S-[3-[(1,3-Dihydro-1,3-dioxo-2H-isoindol-2-yl)oxy]propyl] Ester
TRC-E676460-50MG 50 mg

Ethanethioic Acid S-[3-[(1,3-Dihydro-1,3-dioxo-2H-isoindol-2-yl)oxy]propyl] Ester

Sign In for Pricing
View Details