Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX11 Peptide - N-terminal region

DDX11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CHL1, KRG2, WABS, CHLR1

UniProt

Q96FC9

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001244073.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQKVGAIHFPFPFTPYSIQEDFMAELYRVLEAGKIGIFESPTGTGKSLSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIMAP6 Protein Vector (Mouse) (pPB-C-His)
PV181978 500 ng

GIMAP6 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
FRA6G sgRNA CRISPR Lentivector (Human) (Target 1)
K0805002 1.0 µg DNA

FRA6G sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
IκB-α (phospho Tyr305) Polyclonal Antibody
orb1097479-01 50 μL

IκB-α (phospho Tyr305) Polyclonal Antibody

Sign In for Pricing
View Details
IκB-α (phospho Tyr305) Polyclonal Antibody
orb1097479-02 100 µL

IκB-α (phospho Tyr305) Polyclonal Antibody

Sign In for Pricing
View Details
Il20rb sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4672306 1.0 µg DNA

Il20rb sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
SLAMF7 (NM_021181) Human Tagged ORF Clone
RC220985 10 µg

SLAMF7 (NM_021181) Human Tagged ORF Clone

Sign In for Pricing
View Details