Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX11 Peptide - N-terminal region

DDX11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CHL1, KRG2, WABS, CHLR1

UniProt

Q96FC9

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001244073.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQKVGAIHFPFPFTPYSIQEDFMAELYRVLEAGKIGIFESPTGTGKSLSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUPER-X PLEX ® Human CRP Antigen Standard
HPX995S 96 Tests

SUPER-X PLEX ® Human CRP Antigen Standard

Sign In for Pricing
View Details
CDC42EP4 Antibody
orb673446-01 50 µg

CDC42EP4 Antibody

Sign In for Pricing
View Details
CDC42EP4 Antibody
orb673446-02 100 µg

CDC42EP4 Antibody

Sign In for Pricing
View Details
U3 Small Nucleolar RNA-Associated Protein 6 Homolog (UTP6) Antibody
abx239351 100 µg

U3 Small Nucleolar RNA-Associated Protein 6 Homolog (UTP6) Antibody

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup A / serotype 4A DNA primase (dnaG), partial
MBS1216282 Inquire

Recombinant Neisseria meningitidis serogroup A / serotype 4A DNA primase (dnaG), partial

Sign In for Pricing
View Details
Recombinant Human PPCDC Protein
ARP3469-01 10 µg

Recombinant Human PPCDC Protein

Sign In for Pricing
View Details