Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUSC1 Peptide - middle region

RUSC1 Peptide - middle region

Product Specifications

Product Name Alternative

NESCA

UniProt

Q9BVN2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001098673.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSWKINPIWKIDTEKTKAEWKTTENNNTGWKNNGNVNSSWKSEPEKFDSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Formononetin
300277 20 mg

Formononetin

Sign In for Pricing
View Details
Anti-RPL13A Antibody Picoband®, Cy3 Conjugate
A03571-1-Cy3 100 µg/Vial

Anti-RPL13A Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
HMGN3 Blocking Peptide
MBS9632325-01 1 mg

HMGN3 Blocking Peptide

Sign In for Pricing
View Details
HMGN3 Blocking Peptide
MBS9632325-02 5x 1 mg

HMGN3 Blocking Peptide

Sign In for Pricing
View Details
Hpn Protein Vector (Mouse) (pPM-C-HA)
PV189744 500 ng

Hpn Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
FRMD3 (EPB41L4O, FERM Domain-containing Protein 3, Band 4.1-like Protein 4O, 4.1O, Ovary Type Protein 4.1, MGC20553, P410) (FITC)
126983-FITC 100 µL

FRMD3 (EPB41L4O, FERM Domain-containing Protein 3, Band 4.1-like Protein 4O, 4.1O, Ovary Type Protein 4.1, MGC20553, P410) (FITC)

Sign In for Pricing
View Details