RUSC1 Peptide - middle region
RUSC1 Peptide - middle region
Product Specifications
Product Name Alternative
NESCA
UniProt
Q9BVN2
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001098673.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PSWKINPIWKIDTEKTKAEWKTTENNNTGWKNNGNVNSSWKSEPEKFDSG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2610977-01 48 Well
Human zinc finger and BTB domain containing 10 (ZBTB10) ELISA Kit
Sign In for Pricing
View Details MBS2610977-02 96 Well
Human zinc finger and BTB domain containing 10 (ZBTB10) ELISA Kit
Sign In for Pricing
View Details MBS2610977-03 5x 96 Well
Human zinc finger and BTB domain containing 10 (ZBTB10) ELISA Kit
Sign In for Pricing
View Details MBS2610977-04 10x 96 Well
Human zinc finger and BTB domain containing 10 (ZBTB10) ELISA Kit
Sign In for Pricing
View Details 