Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAB1 Peptide - N-terminal region

DAB1 Peptide - N-terminal region

Product Specifications

UniProt

O75553

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066566.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CA242 Calibrator Grade
OPMA00003-50KIU 50 KU

Human CA242 Calibrator Grade

Sign In for Pricing
View Details
Goat anti-T1R3 Antibody
dAP-1556 50 µg

Goat anti-T1R3 Antibody

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Eukaryotic translation initiation factor 3 subunit B (SPAC25G10.08), partial
MBS1290194 Inquire

Recombinant Schizosaccharomyces pombe Eukaryotic translation initiation factor 3 subunit B (SPAC25G10.08), partial

Sign In for Pricing
View Details
AGPAT4 Antibody
orb758427-01 25 µg

AGPAT4 Antibody

Sign In for Pricing
View Details
AGPAT4 Antibody
orb758427-02 50 µg

AGPAT4 Antibody

Sign In for Pricing
View Details
AGPAT4 Antibody
orb758427-03 100 µg

AGPAT4 Antibody

Sign In for Pricing
View Details