Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM97 Peptide - C-terminal region

TMEM97 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAC30

UniProt

Q5BJF2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055388.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO9B siRNA (Human)
orb1865184-01 15 nmol

MYO9B siRNA (Human)

Sign In for Pricing
View Details
MYO9B siRNA (Human)
orb1865184-02 30 nmol

MYO9B siRNA (Human)

Sign In for Pricing
View Details
Recombinant Human TRPC4AP Protein, N-His
HP705012-01 50 µg

Recombinant Human TRPC4AP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TRPC4AP Protein, N-His
HP705012-02 100 µg

Recombinant Human TRPC4AP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TRPC4AP Protein, N-His
HP705012-03 1 mg

Recombinant Human TRPC4AP Protein, N-His

Sign In for Pricing
View Details
Rabbit Polyclonal HOGA1 Antibody [DyLight 405]
NBP3-06562V 0.1 mL

Rabbit Polyclonal HOGA1 Antibody [DyLight 405]

Sign In for Pricing
View Details