What is the catalog number for TMEM97 Peptide - C-terminal region?

The catalog number for TMEM97 Peptide - C-terminal region is orb1999521.

What sizes are available for TMEM97 Peptide - C-terminal region?

TMEM97 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is TMEM97 Peptide - C-terminal region in stock?

TMEM97 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

TMEM97 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAC30

UniProt

Q5BJF2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055388.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-313473 1 mg

3-Oxo-3- (3-thienyl) propanenitrile

Sign In for Pricing

View Details

abx493662-01 96 Tests

Rat Carnitine Acetyltransferase (CRAT) CLIA Kit

Sign In for Pricing

View Details

abx493662-02 5x 96 Tests

Rat Carnitine Acetyltransferase (CRAT) CLIA Kit

Sign In for Pricing

View Details

abx493662-03 10x 96 Tests

Rat Carnitine Acetyltransferase (CRAT) CLIA Kit

Sign In for Pricing

View Details

ABF0185 100 µg

Integrin beta-5 Antibody

Sign In for Pricing

View Details

GTR10424599 96 Well

Guinea Pig Translocator protein ELISA kit

Sign In for Pricing

View Details