Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSR1 Peptide - middle region

MSR1 Peptide - middle region

Product Specifications

Product Name Alternative

SRA, SR-A, CD204, phSR1, phSR2, SCARA1

UniProt

P21757

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002436.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NITNDLRLKDWEHSQTLRNITLIQGPPGPPGEKGDRGPTGESGPRGFPGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX6 Polyclonal Antibody
E-AB-19196-01 20 µL

STX6 Polyclonal Antibody

Sign In for Pricing
View Details
STX6 Polyclonal Antibody
E-AB-19196-02 60 µL

STX6 Polyclonal Antibody

Sign In for Pricing
View Details
STX6 Polyclonal Antibody
E-AB-19196-03 120 µL

STX6 Polyclonal Antibody

Sign In for Pricing
View Details
STX6 Polyclonal Antibody
E-AB-19196-04 200 µL

STX6 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-36b/IL-36b Protein
PKSM041093-01 10 µg

Recombinant Mouse Interleukin-36b/IL-36b Protein

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-36b/IL-36b Protein
PKSM041093-02 50 µg

Recombinant Mouse Interleukin-36b/IL-36b Protein

Sign In for Pricing
View Details