Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSR1 Peptide - middle region

MSR1 Peptide - middle region

Product Specifications

Product Name Alternative

SRA, SR-A, CD204, phSR1, phSR2, SCARA1

UniProt

P21757

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002436.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NITNDLRLKDWEHSQTLRNITLIQGPPGPPGEKGDRGPTGESGPRGFPGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Cyclohexenylcarboxylic Acid
TRC-C988195-50G 50 g

3-Cyclohexenylcarboxylic Acid

Sign In for Pricing
View Details
Zanubrutinib-13C3
TRC-Z215235-25MG 25 mg

Zanubrutinib-13C3

Sign In for Pricing
View Details
(S)-Monepantel Sulfone
TRC-M515820-5MG 5 mg

(S)-Monepantel Sulfone

Sign In for Pricing
View Details
Etoxazole
TRC-E936600-25G 25 g

Etoxazole

Sign In for Pricing
View Details
Elab Fluor® Red 780 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783S-01 25 µg

Elab Fluor® Red 780 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783S-02 100 µg

Elab Fluor® Red 780 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details