NCR3 Peptide - middle region
NCR3 Peptide - middle region
Product Specifications
Product Name Alternative
1C7, MALS, CD337, LY117, NKp30
UniProt
O14931
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001138938.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2161306 1.0 µg DNA
SLC6A10P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
MBS6421598-01 0.1 mL
HSP90B1 (Heat Shock Protein 90kD Beta 1, ECGP, GP96, GRP94, TRA1) (MaxLight 650)
Sign In for Pricing
View Details MBS6421598-02 5x 0.1 mL
HSP90B1 (Heat Shock Protein 90kD Beta 1, ECGP, GP96, GRP94, TRA1) (MaxLight 650)
Sign In for Pricing
View Details