What is the catalog number for NCR3 Peptide - middle region?

The catalog number for NCR3 Peptide - middle region is orb1999486.

What sizes are available for NCR3 Peptide - middle region?

NCR3 Peptide - middle region is available in the following size(s): 100 µg.

Is NCR3 Peptide - middle region in stock?

NCR3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

NCR3 Peptide - middle region

Product Specifications

Product Name Alternative

1C7, MALS, CD337, LY117, NKp30

UniProt

O14931

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138938.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E10-30852 100 µL

Mouse Monoclonal Antibody to Rab8

Sign In for Pricing

View Details

sc-429647 20 µg

PARC CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing

View Details

46788174 3x 5 nmol

Tlx3 siRNA Oligos set (Mouse)

Sign In for Pricing

View Details

bs-5659R-PE-Cy5 100 µL

Phospho-RAD9 (Tyr28) Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing

View Details

E28PN2688 100 µL

T2R38 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

E11-201962 100 µg -100 µL

FAM3B Polyclonal Antibody

Sign In for Pricing

View Details