NCR3 Peptide - middle region
NCR3 Peptide - middle region
Product Specifications
Product Name Alternative
1C7, MALS, CD337, LY117, NKp30
UniProt
O14931
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001138938.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC205013L2V 200 µL
SSB (NM_003142) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
C11979 100 µL
NMDAR1 (Phospho-Ser890) Polyclonal Conjugated Antibody
Sign In for Pricing
View Details 
MBS6282895-01 0.2 mL
CD1E, ID (CD1E, T-cell surface glycoprotein CD1e, membrane-associated, R2G1, CD1e, T-cell surface glycoprotein CD1e, soluble) (APC)
Sign In for Pricing
View Details MBS6282895-02 5x 0.2 mL
CD1E, ID (CD1E, T-cell surface glycoprotein CD1e, membrane-associated, R2G1, CD1e, T-cell surface glycoprotein CD1e, soluble) (APC)
Sign In for Pricing
View Details