Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB1B Peptide - C-terminal region

RAB1B Peptide - C-terminal region

Product Specifications

UniProt

Q9H0U4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_112243.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Secreted frizzled related protein 3 (FRZB) ELISA Kit
GTR10316908 96 Well

Human Secreted frizzled related protein 3 (FRZB) ELISA Kit

Sign In for Pricing
View Details
TFCP2 Antibody
OACA07889-50UL 50 µL

TFCP2 Antibody

Sign In for Pricing
View Details
Uronyl 2-sulfotransferase (UST) Antibody
abx349810-01 20 µg

Uronyl 2-sulfotransferase (UST) Antibody

Sign In for Pricing
View Details
Uronyl 2-sulfotransferase (UST) Antibody
abx349810-02 50 µg

Uronyl 2-sulfotransferase (UST) Antibody

Sign In for Pricing
View Details
Uronyl 2-sulfotransferase (UST) Antibody
abx349810-03 100 µg

Uronyl 2-sulfotransferase (UST) Antibody

Sign In for Pricing
View Details
Uronyl 2-sulfotransferase (UST) Antibody
abx349810-04 200 µg

Uronyl 2-sulfotransferase (UST) Antibody

Sign In for Pricing
View Details