Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB1B Peptide - C-terminal region

RAB1B Peptide - C-terminal region

Product Specifications

UniProt

Q9H0U4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_112243.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pofut1 Pre-designed siRNA Set A
SI110845A 1 Each

Mouse Pofut1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CD9 discontinued
381132 200 µL

CD9 discontinued

Sign In for Pricing
View Details
6-Chloroacetyl-1,4-benzodioxane 98+% (HPLC)
234649-01 1 g

6-Chloroacetyl-1,4-benzodioxane 98+% (HPLC)

Sign In for Pricing
View Details
6-Chloroacetyl-1,4-benzodioxane 98+% (HPLC)
234649-02 5 g

6-Chloroacetyl-1,4-benzodioxane 98+% (HPLC)

Sign In for Pricing
View Details
6-Chloroacetyl-1,4-benzodioxane 98+% (HPLC)
234649-03 25 g

6-Chloroacetyl-1,4-benzodioxane 98+% (HPLC)

Sign In for Pricing
View Details
6-Chloroacetyl-1,4-benzodioxane 98+% (HPLC)
234649-04 100 g

6-Chloroacetyl-1,4-benzodioxane 98+% (HPLC)

Sign In for Pricing
View Details