Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3GLB1 Peptide - C-terminal region

SH3GLB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Bif-1, CGI-61, PPP1R70, dJ612B15.2

UniProt

Q9Y371

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001193580.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Rabbit Monoclonal Antibody [Clone ID: Hermes -3]
TA386030 200 µg

CD44 Rabbit Monoclonal Antibody [Clone ID: Hermes -3]

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS703012 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Recombinant Human FOLR2/FBP Protein (His Tag)
PKSH031199 100 µg

Recombinant Human FOLR2/FBP Protein (His Tag)

Sign In for Pricing
View Details
ZNF415 Human Gene Knockout Kit (CRISPR)
KN417984 1 Kit

ZNF415 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MEF2C Rabbit Monoclonal Antibody
TA423621 100 µL

MEF2C Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Bad Recombinant Rabbit monoclonal Antibody
HA750025 100 µL

Bad Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details