Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3GLB1 Peptide - C-terminal region

SH3GLB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Bif-1, CGI-61, PPP1R70, dJ612B15.2

UniProt

Q9Y371

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001193580.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proteasome 20S beta 7 (PSMB7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]
TA504638BM 100 µL

Proteasome 20S beta 7 (PSMB7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]

Sign In for Pricing
View Details
Slc39a8 Mouse Gene Knockout Kit (CRISPR)
KN516112 1 Kit

Slc39a8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pigment Yellow 12 (Technical Grade)
TRC-P437838-5G 5 g

Pigment Yellow 12 (Technical Grade)

Sign In for Pricing
View Details
APPD (PLEKHF1) (N-term) Rabbit Polyclonal Antibody
AP53348PU-N 400 µL

APPD (PLEKHF1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tmem127 Mouse Gene Knockout Kit (CRISPR)
KN517712 1 Kit

Tmem127 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MIR3919 Human qPCR Primer Pair (MI0016425)
HP300896 200 Reactions

MIR3919 Human qPCR Primer Pair (MI0016425)

Sign In for Pricing
View Details