What is the catalog number for MED8 Peptide - middle region?

The catalog number for MED8 Peptide - middle region is orb1999442.

What sizes are available for MED8 Peptide - middle region?

MED8 Peptide - middle region is available in the following size(s): 100 µg.

Is MED8 Peptide - middle region in stock?

MED8 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MED8 Peptide - middle region

Product Specifications

Product Name Alternative

ARC32

UniProt

Q96G25

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001001653.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFGKGLSNWRPSGSSGPGQAGQPGAGTILAGTSGLQQVQMAGAPSQQQPM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TA501816 100 µL

PUS7 Mouse Monoclonal Antibody [Clone ID: OTI4C6]

Sign In for Pricing

View Details

GTR15135159 1 Vial

Lentiviral human SLC25A40 shRNA (UAS) - Lentiviral human SLC25A40 shRNA (UAS, iRFP) (100)

Sign In for Pricing

View Details

E45H36443M5 20 µg

PTPRN2 (NM_130842) Human Recombinant Protein

Sign In for Pricing

View Details

2524-0000 1 Each

24-place aluminum block for 0.5 mL tubes, for Thermal-Lok dry bath. 3 W x 3.75 D x 2 H.

Sign In for Pricing

View Details

30R-AD001 1 mg

D-Dimer protein

Sign In for Pricing

View Details

PA5980-01 50 μL

Rabbit Anti-Human FLT4 pAb

Sign In for Pricing

View Details