What is the catalog number for MED8 Peptide - middle region?

The catalog number for MED8 Peptide - middle region is orb1999442.

What sizes are available for MED8 Peptide - middle region?

MED8 Peptide - middle region is available in the following size(s): 100 µg.

Is MED8 Peptide - middle region in stock?

MED8 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MED8 Peptide - middle region

Product Specifications

Product Name Alternative

ARC32

UniProt

Q96G25

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001001653.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFGKGLSNWRPSGSSGPGQAGQPGAGTILAGTSGLQQVQMAGAPSQQQPM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMM82840-01 1 Each

UPK3B Mouse Monoclonal Antibody

Sign In for Pricing

View Details

AMM82840-02 50 µL

UPK3B Mouse Monoclonal Antibody

Sign In for Pricing

View Details

AMM82840-03 100 µL

UPK3B Mouse Monoclonal Antibody

Sign In for Pricing

View Details

NB100-77855V 0.1 mL

Mouse Monoclonal HLA-DR Antibody (L243) [DyLight 405]

Sign In for Pricing

View Details

LH09881V 100 µg

ZDHHC9 (NM_016032) Human Over-expression Lysate

Sign In for Pricing

View Details

RD20134F-01 25 µg

PE Anti-Mouse F4/80 Antibody

Sign In for Pricing

View Details