Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFAIP1 Peptide - middle region

TNFAIP1 Peptide - middle region

Product Specifications

Product Name Alternative

B12, B61, EDP1, BTBD34, hBACURD2

UniProt

Q13829

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066960.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYSYTSNSDDH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal NRGN / Neurogranin Antibody (Internal)
AMM06825G 0.05mg

Polyclonal NRGN / Neurogranin Antibody (Internal)

Sign In for Pricing
View Details
OLFML2B CRISPR/Cas9 KO Plasmid (h)
sc-408524 20 µg

OLFML2B CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human OR51D1 (Olfactory receptor family 51 subfamily D member 1) for Antibody Discovery
MP0742X Each

Magic™ Membrane Protein Human OR51D1 (Olfactory receptor family 51 subfamily D member 1) for Antibody Discovery

Sign In for Pricing
View Details
PLP2 Adenovirus (Rat)
37028056 1.0 mL

PLP2 Adenovirus (Rat)

Sign In for Pricing
View Details
POL H CRISPR Activation Plasmid (m)
sc-429845-ACT 20 µg

POL H CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Human CSNK1G1 Protein, His & GST Tag
KMPH3264-01 20 µg

Human CSNK1G1 Protein, His & GST Tag

Sign In for Pricing
View Details