Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFAIP1 Peptide - middle region

TNFAIP1 Peptide - middle region

Product Specifications

Product Name Alternative

B12, B61, EDP1, BTBD34, hBACURD2

UniProt

Q13829

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066960.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYSYTSNSDDH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DROSHA Antibody Picoband® Fluoro550 Conjugated
A00111-3-Fluoro550 100 µg/Vial

Anti-DROSHA Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Goat Cytochrome-C ELISA Kit
GTR10352587 96 Well

Goat Cytochrome-C ELISA Kit

Sign In for Pricing
View Details
NPM1 Human
OM305393-01 5 µg

NPM1 Human

Sign In for Pricing
View Details
NPM1 Human
OM305393-02 20 µg

NPM1 Human

Sign In for Pricing
View Details
NPM1 Human
OM305393-03 1 mg

NPM1 Human

Sign In for Pricing
View Details
Leptin Receptor (LEPR) Rabbit anti-Human Polyclonal (aa37-52) Antibody
GWB-F0C0A0 0.05 mg

Leptin Receptor (LEPR) Rabbit anti-Human Polyclonal (aa37-52) Antibody

Sign In for Pricing
View Details