RANBP10 Peptide - middle region
RANBP10 Peptide - middle region
Product Specifications
UniProt
Q6VN20
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_065901.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SLSSRSPKSQDSYPGSPSLSPRHGPSSSHMHNTGADSPSCSNGVASTKSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15096323 1 Vial
Lentiviral human KIAA0232 shRNA (UAS) - Lentiviral human KIAA0232 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details 
248379 100 µg
MAF (V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog (avian), MGC71685, c-MAF)
Sign In for Pricing
View Details MBS1250388-01 0.02 mg (E-Coli)
Recombinant Campylobacter jejuni subsp. doylei RNA pyrophosphohydrolase (rppH)
Sign In for Pricing
View Details