ERMAP Peptide - middle region
ERMAP Peptide - middle region
Product Specifications
Product Name Alternative
RD, SC, BTN5, PRO2801
UniProt
Q96PL5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001017922.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TN8499-01 10 mg
3- (4-methyloxybenzyl) -7,8-methylenedioxychroman-4-one
Sign In for Pricing
View Details TN8499-02 50 mg
3- (4-methyloxybenzyl) -7,8-methylenedioxychroman-4-one
Sign In for Pricing
View Details AVI2078-050 50 µg
Recombinant Human LILRB2/CD85d/ILT4 Fc Avi-tag Protein CF
Sign In for Pricing
View Details 