ERMAP Peptide - middle region
ERMAP Peptide - middle region
Product Specifications
Product Name Alternative
RD, SC, BTN5, PRO2801
UniProt
Q96PL5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001017922.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
134445 100 µg
TIM-1 (T Cell Immunoglobin Domain and Mucin Domain Protein 1, TIM 1, TIM1, TIMD 1, TIMD1, TIMD-1, Hepatitis A Virus Cellular Receptor 1, HAVCR 1, HAVCR1, HAVCR-1, Kidney Injury Molecule 1, KIM1, KIM-1)
Sign In for Pricing
View Details bs-12948R-BF750 100 µL
CRTAC1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
Sign In for Pricing
View Details