What is the catalog number for MRPL3 Peptide - middle region?

The catalog number for MRPL3 Peptide - middle region is orb1999375.

What sizes are available for MRPL3 Peptide - middle region?

MRPL3 Peptide - middle region is available in the following size(s): 100 µg.

Is MRPL3 Peptide - middle region in stock?

MRPL3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MRPL3 Peptide - middle region

Product Specifications

Product Name Alternative

MRL3, RPML3, COXPD9

UniProt

P09001

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009139.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAVATGDIGRVWPGTKMP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E90757 100 µL

ATF2 Rabbit pAb

Sign In for Pricing

View Details

DAG-H10736 100 µg

Recombinant IAV H1N1 (A/Auckland/606/2001) Neuraminidase [His]

Sign In for Pricing

View Details

HY-RI02277-01 5 nmol

Hsa-miR-6857-5p inhibitor

Sign In for Pricing

View Details

HY-RI02277-02 20 nmol

Hsa-miR-6857-5p inhibitor

Sign In for Pricing

View Details

sc-412235 20 µg

DUSP24 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing

View Details

CRM3950-01 15 nmol

SLK siRNA (Mouse)

Sign In for Pricing

View Details