Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCAM1 Peptide - C-terminal region

NCAM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD56, NCAM, MSK39

UniProt

P13591

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000606.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETDB1 (NM_012432) Human Over-expression Lysate
LC402212 20 µg

SETDB1 (NM_012432) Human Over-expression Lysate

Sign In for Pricing
View Details
ALIX Recombinant Rabbit Monoclonal Antibody [JM85-31]
ET1705-74 100 µL

ALIX Recombinant Rabbit Monoclonal Antibody [JM85-31]

Sign In for Pricing
View Details
TBR1 Recombinant Chimeric Antibody Antibody
HA601422 100 µL

TBR1 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
SF3B3 Polyclonal Antibody
E-AB-19022-01 20 µL

SF3B3 Polyclonal Antibody

Sign In for Pricing
View Details
SF3B3 Polyclonal Antibody
E-AB-19022-02 60 µL

SF3B3 Polyclonal Antibody

Sign In for Pricing
View Details
SF3B3 Polyclonal Antibody
E-AB-19022-03 120 µL

SF3B3 Polyclonal Antibody

Sign In for Pricing
View Details