Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R1 Peptide - middle region

PPP4R1 Peptide - middle region

Product Specifications

Product Name Alternative

MEG1, PP4R1, PP4 (Rmeg)

UniProt

Q8TF05

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035847.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSFHFWRTPLPEIDLDIELEQNSGGKPSPEGPEEESEGPVPSSPNITMAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOB.1 (B-Cell Marker) (BOB1/2423), CF488A conjugate, 0.1mg/mL
BNC882423-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2423), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP-16 Antibody
8C0268-AAT 50 µg

MMP-16 Antibody

Sign In for Pricing
View Details
KRTAP2-2 (NM_033032) Human Over-expression Lysate
LY432121 100 µg

KRTAP2-2 (NM_033032) Human Over-expression Lysate

Sign In for Pricing
View Details
5-Benzylindoline-2,3-dione
TRC-B194835-25MG 25 mg

5-Benzylindoline-2,3-dione

Sign In for Pricing
View Details
10-Heneicosanone
TRC-H105390-10MG 10 mg

10-Heneicosanone

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
BNC472216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details