Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R1 Peptide - middle region

PPP4R1 Peptide - middle region

Product Specifications

Product Name Alternative

MEG1, PP4R1, PP4 (Rmeg)

UniProt

Q8TF05

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035847.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSFHFWRTPLPEIDLDIELEQNSGGKPSPEGPEEESEGPVPSSPNITMAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6 pSer235 Rabbit Polyclonal Antibody
AP02490PU-S 50 µL

RPS6 pSer235 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-IQCC
Y058851 100 µg

Anti-IQCC

Sign In for Pricing
View Details
NUDCD1 (Center) Rabbit Polyclonal Antibody
AP52957PU-N 400 µL

NUDCD1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EMA (MUC1) Human Gene Knockout Kit (CRISPR)
KN419922 1 Kit

EMA (MUC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS623221 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
EGF Antibody
KC-6032-01 50 μL

EGF Antibody

Sign In for Pricing
View Details