CHRM2 Peptide - middle region
CHRM2 Peptide - middle region
Product Specifications
Product Name Alternative
HM2
UniProt
P08172
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_000730.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7216534-01 48 Well
Rabbit ALX homeobox protein 1 (ALX1) ELISA Kit
Sign In for Pricing
View Details MBS7216534-02 96 Well
Rabbit ALX homeobox protein 1 (ALX1) ELISA Kit
Sign In for Pricing
View Details MBS7216534-03 5x 96 Well
Rabbit ALX homeobox protein 1 (ALX1) ELISA Kit
Sign In for Pricing
View Details MBS7216534-04 10x 96 Well
Rabbit ALX homeobox protein 1 (ALX1) ELISA Kit
Sign In for Pricing
View Details 
OKCD04040 96 Well
TIMP4 Chemi-Luminescent ELISA Kit (Rat) (OKCD04040)
Sign In for Pricing
View Details